PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678302170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 276aa    MW: 29350.8 Da    PI: 9.6117
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678302170genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702181.83e-56812234153
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel...kskkqsalsstklssaeskkel 100
                 t+sCqdCGnqakkdC+h+RCRtCCksrgf C+thvkstWvpaa+rr++  + + +         ++ sk++r     ++++++   +  + s+++   +
  678302170  81 RTSSCQDCGNQAKKDCSHRRCRTCCKSRGFYCSTHVKSTWVPAARRRDHDPASSPS---------TSVSKKRRLGgasQTTSTTPPRRLDTISGHQG-GS 170
                6789********************************************74333222.........23333333331101223333344444445444.44 PP

     DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                  +s+P +v ++avfrcvrv+++ddge+++aYq+av igGhvf+G+Ly++ +e
  678302170 171 LRESMPGQVTAPAVFRCVRVAALDDGEDQCAYQAAVRIGGHVFRGFLYEHRVE 223
                4566********************************************99776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.4E-5382222IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.7E-2684126IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.3E-24175219IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MWSSEAAGSR HGVPPEFFFV APGAVPTFDP NATIGVIPLL TAALYHAPPP PPPPPSSEEQ  60
QIQRHTSSSS KKAMSLESSN RTSSCQDCGN QAKKDCSHRR CRTCCKSRGF YCSTHVKSTW  120
VPAARRRDHD PASSPSTSVS KKRRLGGASQ TTSTTPPRRL DTISGHQGGS LRESMPGQVT  180
APAVFRCVRV AALDDGEDQC AYQAAVRIGG HVFRGFLYEH RVEARRGLPN ISDLHLSGRA  240
PSDAPSSSSH LILHPADLGG GSRAGIAGSN YGASLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124143RRRDHDPASSPSTSVSKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838439.13e-78PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK97e-60LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A022R8A64e-78A0A022R8A6_ERYGU; Uncharacterized protein
STRINGBra008898.1-P7e-64(Brassica rapa)
STRINGBra023372.1-P5e-63(Brassica rapa)
STRINGGSMUA_AchrUn_randomP13420_0011e-63(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76552331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-60Lateral root primordium (LRP) protein-related